PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID model.Picochlorum_contig_81.g308.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Picochlorum
Family SBP
Protein Properties Length: 639aa    MW: 70996 Da    PI: 6.8652
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
model.Picochlorum_contig_81.g308.t1genomeRutgersView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP751.3e-2365138277
                                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                                          Cqv gC++  +   +y++++++Ce h+k+p+v+++g+  rfCq+C+rf +l  fD e+rsCr  L++hn+rrr+
  model.Picochlorum_contig_81.g308.t1  65 CQVVGCTNVCE--SSYYKKYRICEEHAKSPAVCIDGEAMRFCQKCARFQSLFSFDAEHRSCRVSLEHHNRRRRQ 136
                                          ******97654..47**********************************************************8 PP

                                          -- CS
                                  SBP  76 kq 77 
                                          ++
  model.Picochlorum_contig_81.g308.t1 137 AK 138
                                          75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.0E-2059124IPR004333Transcription factor, SBP-box
PROSITE profilePS5114121.3562137IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.1E-2063138IPR004333Transcription factor, SBP-box
PfamPF031101.1E-2265136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MAGGNHWRSQ EYAWSPETLV AKRVSERKQA ESSKRGDDAR HVFPEGGVCH KKASRRRAKG  60
APISCQVVGC TNVCESSYYK KYRICEEHAK SPAVCIDGEA MRFCQKCARF QSLFSFDAEH  120
RSCRVSLEHH NRRRRQAKGR SRGKSKAVAK SAVAAVFSEH ELMHLNCVSN GPSQTERSTP  180
SHEDTQSADD AYLSLMKADG SMDVDEYSPE YKEMHLSIKF QEGTPSDLPE SLYDDLLLEV  240
PAVADVVGAI RPGCTHLTTS IRIPAEVHAE FMSSTKPYDM ARRLHKKWFQ SKSLSKGFEV  300
QIEQHATQVT SDGSHVMDRH ALPSPLSLFP CCVSSTKDAC LVDVLGHDIK DSKFVAMCRQ  360
NGRYLTTTML MDESWNDSVF KHVPRSHTSD DETSHGGDSL GSSLESRGSS SICVTDGFDK  420
YDQSDLGSDT SDVNEERNHT EKRSIKIIGL QDGVCEIELV HENSSTPPLA LLILPDPDAV  480
EELQNKITSH QHKPWAQAFL RDVGFVTHHL HGEVPCSMEK MSLVRRAADN LISYSWENGF  540
CALANFLETS IAKHGFPEDT DLLTTKSHKN AISVREVSYS RGLEYVKLAD AKVLLEKIIK  600
LTGITRQPID SGWKGLEHQL IYGSGMLMIA ILVYAASS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-12651361184squamosa promoter binding protein-like 4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.43e-15squamosa promoter binding protein-like 10